CDYL (NM_170752) Human Recombinant Protein
CAT#: TP317438
Recombinant protein of human chromodomain protein, Y-like (CDYL), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217438 representing NM_170752
Red=Cloning site Green=Tags(s) MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLST KSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRN FVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASA NEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANER ECEVLKKIWGSAQGTDSMLKYMQRKIDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_736608 |
Locus ID | 9425 |
UniProt ID | Q9Y232 |
Cytogenetics | 6p25.1 |
Refseq Size | 2805 |
Refseq ORF | 927 |
Synonyms | CDYL1, MGC131936, DKFZp586C1622 |
Summary | Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406868 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406869 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406868 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 2 |
USD 436.00 |
|
LY406869 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 3 |
USD 436.00 |
|
PH317438 | CDYL MS Standard C13 and N15-labeled recombinant protein (NP_736608) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review