CDYL Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 436.00
Specifications
Product Data | |
Applications | IF, WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CDYL antibody: synthetic peptide directed towards the n terminal of human CDYL. Synthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 60 kDa |
Gene Name | chromodomain protein, Y-like |
Database Link | |
Background | CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. |
Synonyms | CDYL1 |
Note | Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review