Germany
Japan
United Kingdom
China
Antibodies
View as table Download
NAMPT Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NAMPT |
Rabbit Polyclonal Anti-NADSYN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: NQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISL |
Rabbit Polyclonal Anti-NADSYN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG |
Rabbit Polyclonal Anti-C9orf95 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST |
Rabbit polyclonal anti-NT5E antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Rabbit Polyclonal Anti-NT5C3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Rabbit Polyclonal Anti-NT5C1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR |
Rabbit Polyclonal Anti-NT5C1B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C1B antibody: synthetic peptide directed towards the N terminal of human NT5C1B. Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
Rabbit Polyclonal Anti-NT5M Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the middle region of human NT5M. Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV |
Rabbit Polyclonal Anti-NT5M Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5M antibody: synthetic peptide directed towards the N terminal of human NT5M. Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL |
Rabbit Polyclonal Anti-PBEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL |
Rabbit Polyclonal Anti-NMNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL |
Rabbit Polyclonal Anti-NT5C3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
Active filters
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- Nicotinate and nicotinamide metabolism