NAD Synthetase (NADSYN1) Rabbit Polyclonal Antibody

CAT#: TA334336

Rabbit Polyclonal Anti-NADSYN1 Antibody

Product Images

Host: Rabbit; Target Name: NADSYN1; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: NAD synthetase 1
• Database Link:
  NP_060631
  Entrez Gene 55191 Human
  UniProt ID Q6IA69
• Background: Nicotinamide adenine dinucleotide (NAD) is a coenzyme in metabolic redox reactions, a precursor for several cell signaling molecules, and a substrate for protein posttranslational modifications. NAD synthetase (EC 6.3.5.1) catalyzes the final step in the biosynthesis of NAD from nicotinic acid adenine dinucleotide (NaAD).
• Synonyms: FLJ10631; FLJ36703; FLJ40627
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Yeast: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Goat: 85%

Reference Data

• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism