Germany
Japan
United Kingdom
China
C9orf95 (NMRK1) Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 1
USD 436.00
Recombinant protein of human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1, 20 µg
USD 867.00
Other products for "C9orf95"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 23 kDa |
| Gene Name | nicotinamide riboside kinase 1 |
| Database Link | |
| Background | The function of C9orf95 remains unknown. |
| Synonyms | bA235O14.2; C9orf95; NRK1 |
| Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 79%; Mouse: 79%; Zebrafish: 75% |
| Reference Data | |
| Protein Pathways | Nicotinate and nicotinamide metabolism |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.