C9orf95 (NMRK1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 1
USD 436.00
Recombinant protein of human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1, 20 µg
USD 867.00
Other products for "C9orf95"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 23 kDa |
Gene Name | nicotinamide riboside kinase 1 |
Database Link | |
Background | The function of C9orf95 remains unknown. |
Synonyms | bA235O14.2; C9orf95; NRK1 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 79%; Mouse: 79%; Zebrafish: 75% |
Reference Data | |
Protein Pathways | Nicotinate and nicotinamide metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.