Ing1 (NM_011919) Mouse Recombinant Protein

CAT#: TP525175

Purified recombinant protein of Mouse inhibitor of growth family, member 1 (Ing1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Ing1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225175 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRETDGTQKRRV
  LHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGSGKAGQDKSKSEAIT
  QADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP
  TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGESEKTMDKALEKSKKERAYNR
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 32.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036049
• Locus ID: 26356
• UniProt ID: Q9QXV3
• Cytogenetics: 8 A1.1
• Refseq Size: 2813
• Refseq ORF: 840
• Synonyms: 2610028J21Rik; AA407184; AI875420; mING1h; p33Ing1; p37Ing1b
• Summary: Isoform 1 inhibits p53-dependent transcriptional activation and may function as an oncoprotein. Isoform 2 acts as a negative growth regulator by cooperating with p53 in transcriptional activation of p53-responsive genes and may act as a tumor suppressor.[UniProtKB/Swiss-Prot Function]