Rabbit Polyclonal ING1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal ING1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Anti-ING1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ING1 antibody: synthetic peptide directed towards the N terminal of human ING1. Synthetic peptide located within the following region: SPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGS |
Rabbit Polyclonal Anti-ING1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ING1 antibody: synthetic peptide directed towards the C terminal of human ING1. Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD |
Rabbit Polyclonal Anti-ING1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ING1 |
Goat polyclonal anti-p33 ING1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole Goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 285-296 of Human p33 ING1 protein (Inhibitor of growth family, member 1). This sequence shows 100% homology to all splice variants for ING1. |
ING1 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ING1 |
ING1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ING1 |
ING1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ING1 |
Modifications | Unmodified |