MDP1 (NM_138476) Human Recombinant Protein
CAT#: TP308609
Recombinant protein of human magnesium-dependent phosphatase 1 (MDP-1), 20 µg
View other "MDP1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208609 protein sequence
Red=Cloning site Green=Tags(s) MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASR TSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIH IQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612485 |
Locus ID | 145553 |
UniProt ID | Q86V88 |
Cytogenetics | 14q12 |
Refseq Size | 760 |
Refseq ORF | 528 |
Synonyms | FN6PASE; MDP-1 |
Summary | Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403357 | MDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403357 | Transient overexpression lysate of magnesium-dependent phosphatase 1 (MDP1) |
USD 436.00 |
|
PH308609 | MDP1 MS Standard C13 and N15-labeled recombinant protein (NP_612485) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review