MDP1 Rabbit Polyclonal Antibody

CAT#: TA340302

Rabbit Polyclonal Anti-MDP-1 Antibody

Product Images

WB Suggested Anti-MDP-1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MDP-1 antibody: synthetic peptide directed towards the N terminal of human MDP-1. Synthetic peptide located within the following region: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: magnesium-dependent phosphatase 1
• Database Link:
  NP_612485
  Entrez Gene 145553 Human
  UniProt ID Q86V88
• Background: MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
• Synonyms: FN6PASE; MDP-1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Yeast: 92%; Zebrafish: 92%; Goat: 85%