SEPTIN1 (NM_052838) Human Mass Spec Standard

CAT#: PH304253

SEPT1 MS Standard C13 and N15-labeled recombinant protein (NP_443070)

Product Images

Coomassie blue staining of purified SEPTIN1 protein (Cat# TP304253). The protein was produced from HEK293T cells transfected with SEPTIN1 cDNA clone (Cat# RC204253) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204253
• Predicted MW: 42 kDa
• Protein Sequence:
  Sequence Link

  >RC204253 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIE
  RRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYF
  ISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDE
  DFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEV
  THDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM
  QAQMQQSQAQGEQSDAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443070
• RefSeq Size: 1609
• RefSeq ORF: 1101
• Synonyms: DIFF6; LARP; PNUTL3; SEP1; SEPT1
• Locus ID: 1731
• UniProt ID: Q8WYJ6, J3KNL2
• Cytogenetics: 16p11.2
• Summary: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined. [provided by RefSeq, Dec 2012]