SEPTIN1 (NM_052838) Human Recombinant Protein

CAT#: TP304253M

Recombinant protein of human septin 1 (SEPT1), 100 µg

Product Images

Coomassie blue staining of purified SEPTIN1 protein (Cat# TP304253). The protein was produced from HEK293T cells transfected with SEPTIN1 cDNA clone (Cat# RC204253) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204253 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIE
  RRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYF
  ISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDE
  DFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEV
  THDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM
  QAQMQQSQAQGEQSDAL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443070
• Locus ID: 1731
• UniProt ID: Q8WYJ6, J3KNL2
• Cytogenetics: 16p11.2
• Refseq Size: 1609
• Refseq ORF: 1101
• Synonyms: DIFF6; LARP; PNUTL3; SEP1; SEPT1
• Summary: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined. [provided by RefSeq, Dec 2012]