TEX19 (NM_207459) Human Tagged ORF Clone

CAT#: RG209297

  • TrueORF®

TEX19 (tGFP-tagged) - Human testis expressed 19 (TEX19)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_207459" in other vectors (4)

Reconstitution Protocol

USD 350.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit polyclonal Anti-FLJ35767 Antibody
    • 100 ul

USD 539.00

Other products for "TEX19"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol TEX19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG209297 representing NM_207459
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCCTCCGGTCAGCATGCGGTATGAGGAAGAGGGCATGTCCTACCTGTACGCCTCCTGGATGTATC
AGCTTCAACATGGAGATCAGCTAAGCATTTGCTTCACCTGCTTCAAGGCTGCCTTTCTAGACTTTAAAGA
CTTGCTGGAGTCAGAGGACTGGGAAGAAGACAACTGGGACCCTGAGCTGATGGAGCACACTGAGGCAGAG
TCAGAGCAGGAGGGGTCCTCAGGGATGGAGCTGAGCTGGGGGCAGAGCCCAGGACAGCCTGTGCAGGGGG
GCTCTGAGGCATGGGGGCCAGGGACCCTGGCAGCAGCCCCAGAAGGGTTGGAAGATGCAGGTCTGGACCC
CCACTTTGTCCCCACTGAACTATGGCCTCAGGAGGCTGTGCCCCTGGGCCTGGGCCTTGAGGATGCTGAC
TGGACCCAGGGTCTTCCCTGGAGATTTGAGGAGCTTCTTACCTGCTCACACTGGCCAAGCTTCTTTCCTT
CA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG209297 representing NM_207459
Red=Cloning site Green=Tags(s)

MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAE
SEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDAD
WTQGLPWRFEELLTCSHWPSFFPS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_207459
ORF Size 492 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_207459.1, NP_997342.1
RefSeq Size 1907 bp
RefSeq ORF 495 bp
Locus ID 400629
UniProt ID Q8NA77
Cytogenetics 17q25.3
Gene Summary Required during spermatogenesis and placenta development, participating in the repression of retrotransposable elements and prevent their mobilization. Collaborates with the Piwi-interacting RNA (piRNA) pathway, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins. Interacts with Piwi proteins and directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Also during spermatogenesis, promotes, with UBR2, SPO11-dependent recombination foci to accumulate and drive robust homologous chromosome synapsis (By similarity). Interacts with LINE-1 retrotransposon encoded LIRE1, stimulates LIRE1 polyubiquitination, mediated by UBR2, and degradation, inhibiting LINE-1 retranstoposon mobilization (PubMed:28806172).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.