C1ORF190 (LURAP1) (NM_001013615) Human Tagged ORF Clone

CAT#: RC206634

LURAP1 (Myc-DDK-tagged)-Human chromosome 1 open reading frame 190 (C1orf190)

Product Images

Circular map for RC206634

• 

  Western blot validation of overexpression lysate (Cat# LY422980) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC206634 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: C1ORF190
• Synonyms: C1orf190; LRAP35a; LRP35A
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC206634 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGGGGACCGTGGAGTCCCAGACGCCTGACCTGCGGGATGTGGAGGGTAAGGTGGGCAGGAAGACCC
  CTGAAGGGCTGCTCCGCGGGCTGCGAGGCGAGTGTGAGCTGGGAACCTCTGGCGCCCTGCTGCTCCCAGG
  GGCGTCTAGCACCGGCCACGACTTGGGGGACAAGATCATGGCGCTGAAGATGGAGCTGGCTTACCTGCGA
  GCCATCGATGTGAAGATCCTGCAGCAGCTGGTGACCTTGAATGAGGGCATCGAGGCAGTGCGCTGGCTGT
  TGGAGGAGCGGGGGACGTTGACCAGTCATTGCAGCAGCCTCACCAGCAGTCAATATAGCCTGACAGGCGG
  GAGCCCAGGCCGCTCAAGGCGAGGCAGCTGGGACAGCCTGCCAGACACCAGCACCACCGACCGGCTGGAC
  AGTGTCTCTATTGGCAGCTTCCTGGACACAGTGGCCCCCAGCGAGCTGGATGAACAGGGCCCACCTGGGG
  CTCCACGTTCCGAGATGGACTGGGCAAAAGTTATAGCTGGTGGAGAGAGGGCCAGGACTGAGGTGGATGT
  GGCAGCCACCAGGCTAGGGAGCTTGAGAGCTGTGTGGAAGCCCCCAGGGGAGAGGCTTCAAGGTGGACCA
  CCTGAGTCACCAGAGGATGAGAGTGCCAAGCTGGGCTTCGAGGCCCACTGGTTCTGGGAGCAGTGCCAGG
  ATGATGTGACCTTCTTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC206634 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLR
  AIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLD
  SVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGP
  PESPEDESAKLGFEAHWFWEQCQDDVTFL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001013615
• ORF Size: 717 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001013615.3
• RefSeq Size: 1863 bp
• RefSeq ORF: 720 bp
• Locus ID: 541468
• UniProt ID: Q96LR2
• Cytogenetics: 1p34.1
• MW: 25.8 kDa
• Gene Summary: Acts as an activator of the canonical NF-kappa-B pathway and drive the production of proinflammatory cytokines. Promotes the antigen (Ag)-presenting and priming function of dendritic cells via the canonical NF-kappa-B pathway (PubMed:21048106). In concert with MYO18A and CDC42BPA/CDC42BPB, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. Activates CDC42BPA/CDC42BPB and targets it to actomyosin through its interaction with MYO18A, leading to MYL9/MLC2 phosphorylation and MYH9/MYH10-dependent actomyosin assembly in the lamella (By similarity).[UniProtKB/Swiss-Prot Function]