C1ORF190 (LURAP1) Rabbit Polyclonal Antibody

CAT#: TA336099

Rabbit Polyclonal Anti-C1orf190 Antibody

Product Images

WB Suggested Anti-C1orf190 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C1orf190 Antibody: synthetic peptide directed towards the middle region of human C1orf190. Synthetic peptide located within the following region: SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: leucine rich adaptor protein 1
• Database Link:
  NP_001013633
  Entrez Gene 541468 Human
  UniProt ID Q96LR2
• Background: The specific function of this protein remains unknown.
• Synonyms: C1orf190; LRAP35a; LRP35A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 86%; Rabbit: 86%