BRD3 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "BRD3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BRD3 antibody: synthetic peptide directed towards the N terminal of human BRD3. Synthetic peptide located within the following region: MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 61 kDa |
Gene Name | bromodomain containing 3 |
Database Link | |
Background | This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. BRD3 is ubiquitously expressed in human adult and fetal tissues. BRD3 is markedly expressed in undifferentiated ES cells, whereas the expression was reduced upon endothelial differentiation. BRD3 plays a role in regulation of cell proliferation by allowing cells to enter the proliferative phase of the angiogenic process.BRD3 is also involved in bladder cancer. |
Synonyms | ORFX; RING3L |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 86% |
Reference Data | |
Protein Families | Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.