BRD3 Rabbit Polyclonal Antibody

CAT#: TA343672

Rabbit Polyclonal Anti-BRD3 Antibody

Product Images

WB Suggested Anti-BRD3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate; BRD3 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRD3 antibody: synthetic peptide directed towards the N terminal of human BRD3. Synthetic peptide located within the following region: MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: bromodomain containing 3
• Database Link:
  NP_031397
  Entrez Gene 8019 Human
  UniProt ID Q15059
• Background: This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. BRD3 is ubiquitously expressed in human adult and fetal tissues. BRD3 is markedly expressed in undifferentiated ES cells, whereas the expression was reduced upon endothelial differentiation. BRD3 plays a role in regulation of cell proliferation by allowing cells to enter the proliferative phase of the angiogenic process.BRD3 is also involved in bladder cancer.
• Synonyms: ORFX; RING3L
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 86%

Reference Data

• Protein Families: Protein Kinase