Rabbit Polyclonal Anti-BRD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BRD3 Antibody: synthetic peptide directed towards the middle region of human BRD3. Synthetic peptide located within the following region: SGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSG |
Rabbit Polyclonal Anti-BRD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD3 antibody: synthetic peptide directed towards the N terminal of human BRD3. Synthetic peptide located within the following region: MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTL |
BRD3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-305 of human BRD3 (NP_031397.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-BRD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD3 antibody: synthetic peptide directed towards the middle region of human BRD3. Synthetic peptide located within the following region: ASGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPS |
BRD3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human BRD3 |
BRD3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BRD3. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
