SSH3BP1 (ABI1) Rabbit Polyclonal Antibody

CAT#: TA343320

Rabbit Polyclonal Anti-ABI1 Antibody

Product Images

Host: Rabbit; Target Name: ABI1; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml ABI1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ABI1. Synthetic peptide located within the following region: MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: abl interactor 1
• Database Link:
  NP_005461
  Entrez Gene 10006 Human
  UniProt ID Q8IZP0
• Background: This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14.
• Synonyms: ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 86%