Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ABI1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This ABI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 81-108 amino acids from the N-terminal region of human ABI1. |
SSH3BP1 (ABI1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human ABI-1 |
Rabbit Polyclonal Anti-ABI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ABI1. Synthetic peptide located within the following region: MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEET |
ABI1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ABI1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SSH3BP1