GLIS2 Rabbit Polyclonal Antibody

CAT#: TA329653

Rabbit Polyclonal anti-GLIS2 antibody

Product Images

WB Suggested Anti-GLIS2 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: GLIS family zinc finger 2
• Database Link:
  NP_115964
  Entrez Gene 84662 Human
  UniProt ID Q9BZE0
• Background: Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription. [supplied by OMIM]
• Synonyms: NKL; NPHP7
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Pig: 86%; Guinea pig: 86%; Rabbit: 85%; Mouse: 83%; Horse: 77%

Reference Data

• Protein Families: ES Cell Differentiation/IPS