Antibodies

Jump to Filters
View as table Download
PTPN5 Rabbit Polyclonal Antibody
TA349114

USD 570.00

5 Days

Rabbit Polyclonal Anti-PTPN5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PTPN5 antibody was raised against an 18 amino acid peptide near the amino terminus of human PTPN5.
GLIS2 Rabbit Polyclonal Antibody
TA329654

USD 539.00

5 Days

Rabbit Polyclonal anti-GLIS2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
GLIS2 Rabbit Polyclonal Antibody
TA349140

USD 570.00

5 Days

Rabbit Polyclonal Anti-GLIS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLIS2 antibody was raised against an 18 amino acid peptide near the center of human GLIS2.
GLIS2 Rabbit Polyclonal Antibody
TA329653

USD 485.00

5 Days

Rabbit Polyclonal anti-GLIS2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
GLIS2 (Center) Rabbit Polyclonal Antibody
AP51852PU-N

USD 580.00

2 Weeks

GLIS2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 172-202 amino acids from the Central region of Human GLIS2.