MSRB3 (NM_001031679) Human Recombinant Protein

CAT#: TP308187

Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified MSRB3 protein (Cat# TP308187). The protein was produced from HEK293T cells transfected with MSRB3 cDNA clone (Cat# RC208187) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208187 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTH
  HKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFD
  DGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001026849
• Locus ID: 253827
• UniProt ID: Q8IXL7
• Cytogenetics: 12q14.3
• Refseq Size: 4434
• Refseq ORF: 555
• Synonyms: DFNB74
• Summary: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010]