MSRB3 (NM_198080) Human Mass Spec Standard

CAT#: PH316512

MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_932346)

Product Images

Coomassie blue staining of purified MSRB3 protein (Cat# TP316512). The protein was produced from HEK293T cells transfected with MSRB3 cDNA clone (Cat# RC216512) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216512
• Predicted MW: 20.5 kDa
• Protein Sequence:
  Sequence Link

  >RC216512 representing NM_198080
  Red=Cloning site Green=Tags(s)
  
  MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESA
  FEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGA
  HLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_932346
• RefSeq Size: 4242
• RefSeq ORF: 576
• Synonyms: DFNB74
• Locus ID: 253827
• UniProt ID: Q8IXL7
• Cytogenetics: 12q14.3
• Summary: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010]