Glutathione Peroxidase 3 (GPX3) (NM_002084) Human Tagged ORF Clone

CAT#: RG207758

GPX3 (GFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Product Images

Circular map for RG207758

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Symbol: Glutathione Peroxidase 3
• Synonyms: GPx-P; GSHPx-3; GSHPx-P
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG207758 representing NM_002084
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTTTCCCTGCTCCTGGCCGGCTTCGTCTCGCAGAGCCGGG
  GACAAGAGAAGTCGAAGATGGACTGCCATGGTGGCATAAGTGGCACCATTTACGAGTACGGAGCCCTCAC
  CATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTATGCTGGCAAATACGTCCTCTTTGTCAACGTGGCC
  AGCTACTGAGGCCTGACGGGCCAGTACATTGAACTGAATGCACTACAGGAAGAGCTTGCACCATTCGGTC
  TGGTCATTCTGGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGAGAGAACTCAGAGATCCTTCC
  TACCCTCAAGTATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTC
  AATGGAGAGAAAGAGCAGAAATTCTACACTTTCCTAAAGAACTCCTGTCCTCCCACCTCGGAGCTCCTGG
  GTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTTCACGACATCCGCTGGAACTTTGAGAAGTTCCT
  GGTGGGGCCAGATGGTATACCCATCATGCGCTGGCACCACCGGACCACGGTCAGCAACGTCAAGATGGAC
  ATCCTGTCCTACATGAGGCGGCAGGCAGCCCTGGGGGTCAAGAGGAAG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG207758 representing NM_002084
  Red=Cloning site Green=Tags(s)
  
  MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVA
  SY*GLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDV
  NGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMD
  ILSYMRRQAALGVKRK
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002084
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002084.5
• RefSeq Size: 1779 bp
• RefSeq ORF: 681 bp
• Locus ID: 2878
• UniProt ID: P22352
• Cytogenetics: 5q33.1
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Arachidonic acid metabolism, Glutathione metabolism
• Gene Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2016]