Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody

CAT#: TA346086

Rabbit Polyclonal Anti-GPX3 Antibody

Product Images

WB Suggested Anti-GPX3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysateGPX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Rabbit Anti-GPX3 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: glutathione peroxidase 3
• Database Link:
  NP_002075
  Entrez Gene 2878 Human
  UniProt ID P22352
• Background: GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.
• Synonyms: GPx-P; GSHPx-3; GSHPx-P
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Dog: 83%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Arachidonic acid metabolism, Glutathione metabolism