Fcer1g (NM_010185) Mouse Tagged ORF Clone
CAT#: MR200193
- TrueORF®
Fcer1g (Myc-DDK-tagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g)
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_010185" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Fcer1g |
Synonyms | AI573376; CD23; Fce1g; FcepsilonRI; FcR-gamma; FcRgamma; FcR[g]; Ly-50 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200193 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCTCAGCCGTGATCTTGTTCTTGCTCCTTTTGGTGGAACAAGCAGCCGCCCTGGGAGAGCCGCAGC TCTGCTATATCCTGGATGCTGTCCTGTTTTTGTATGGTATTGTCCTTACCCTACTCTACTGTCGACTCAA GATCCAGGTCCGAAAGGCAGCTATAGCCAGCCGTGAGAAAGCAGATGCTGTCTACACGGGCCTGAACACC CGGAGCCAGGAGACATATGAGACTCTGAAGCATGAGAAACCACCCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200193 protein sequence
Red=Cloning site Green=Tags(s) MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNT RSQETYETLKHEKPPQ myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_010185 |
ORF Size | 261 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_010185.4, NP_034315.1 |
RefSeq Size | 683 bp |
RefSeq ORF | 261 bp |
Locus ID | 14127 |
UniProt ID | P20491 |
Cytogenetics | 1 79.23 cM |
MW | 9.7 kDa |
Gene Summary | Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells (PubMed:14764707). As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset (PubMed:19098920). Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed:23602766) (Probable). May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation (PubMed:17086186). Also involved in integrin alpha-2/ITGA2-mediated platelet activation (PubMed:9171347).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC201831 | Fcer1g (untagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g), (10ug) |
USD 150.00 |
|
MC201832 | Fcer1g (untagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g), (10ug) |
USD 150.00 |
|
MR200193L3 | Lenti ORF clone of Fcer1g (Myc-DDK-tagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g) |
USD 450.00 |
|
MR200193L4 | Lenti ORF clone of Fcer1g (mGFP-tagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review