Germany
Japan
United Kingdom
China
USD 503.00
2 Weeks
TMEM175 (myc-DDK-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
USD 503.00
2 Weeks
TMEM175 (myc-DDK-tagged) - Human transmembrane protein 175 (TMEM175), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-MGC4618 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM |
TMEM175 (untagged)-Human transmembrane protein 175 (TMEM175)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 769.00
5 Days
Lenti ORF clone of Human transmembrane protein 175 (TMEM175), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 769.00
3 Weeks
Lenti ORF clone of Human transmembrane protein 175 (TMEM175), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 134.00
2 Weeks
TMEM175 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TMEM175 (untagged) - Human transmembrane protein 175 (TMEM175), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TMEM175 (untagged) - Human transmembrane protein 175 (TMEM175), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TMEM175 (untagged) - Human transmembrane protein 175 (TMEM175), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TMEM175 (untagged) - Human transmembrane protein 175 (TMEM175), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TMEM175 (untagged) - Human transmembrane protein 175 (TMEM175), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TMEM175 (untagged) - Human transmembrane protein 175 (TMEM175), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- TRANSMEMBRANE PROTEIN 175
Families
- Transmembrane