Products

View as table Download

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit polyclonal AKT pS473 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to the C-terminus aa 460-480 of human, mouse, rat and chicken AKT proteins conjugated to KLH.

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit Polyclonal Anti-FCGR2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FCGR2B

Anti-AKT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)

Rabbit polyclonal AKT2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2.

Rabbit Polyclonal CD81 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81.

Rabbit polyclonal anti-AKT antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Chicken
Conjugation Unconjugated
Immunogen AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Anti-AKT2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 455-469 amino acids of human v-akt murine thymoma viral oncogene homolog 2

Anti-AKT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.