Research Areas

cDNA Clones (17)
Antibodies (3)
Jump to Filters
View as table Download
USP30 (NM_032663) Human Tagged ORF Clone
RC202538

USD 722.00

In Stock

USP30 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 30 (USP30)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
USP30 (NM_032663) Human Tagged ORF Clone Lentiviral Particle
RC202538L4V

USD 1,272.00

2 Weeks

Lenti ORF particles, USP30 (mGFP-tagged) - Human ubiquitin specific peptidase 30 (USP30), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP30 (NM_032663) Human Tagged ORF Clone Lentiviral Particle
RC202538L1V

USD 1,272.00

2 Weeks

Lenti ORF particles, USP30 (Myc-DDK tagged) - Human ubiquitin specific peptidase 30 (USP30), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
USP30 (NM_032663) Human Tagged ORF Clone Lentiviral Particle
RC202538L2V

USD 1,272.00

5 Weeks

Lenti ORF particles, USP30 (mGFP-tagged) - Human ubiquitin specific peptidase 30 (USP30), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
USP30 (NM_032663) Human Tagged ORF Clone Lentiviral Particle
RC202538L3V

USD 1,272.00

2 Weeks

Lenti ORF particles, USP30 (Myc-DDK tagged) - Human ubiquitin specific peptidase 30 (USP30), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP30 (NM_032663) Human Tagged ORF Clone
RG202538

USD 922.00

In Stock

USP30 (tGFP-tagged) - Human ubiquitin specific peptidase 30 (USP30)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP30 (NM_001301175) Human Tagged ORF Clone
RG238509

USD 703.00

2 Weeks

USP30 (tGFP-tagged) - Human ubiquitin specific peptidase 30 (USP30), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP30 (NM_001301175) Human Tagged ORF Clone
RC238509

USD 503.00

2 Weeks

USP30 (myc-DDK-tagged) - Human ubiquitin specific peptidase 30 (USP30), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
USP30 (NM_032663) Human Tagged Lenti ORF Clone
RC202538L1

USD 1,022.00

In Stock

Lenti ORF clone of Human ubiquitin specific peptidase 30 (USP30), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
USP30 (NM_032663) Human Tagged Lenti ORF Clone
RC202538L3

USD 1,022.00

In Stock

Lenti ORF clone of Human ubiquitin specific peptidase 30 (USP30), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP30 Rabbit Polyclonal Antibody
TA339620

USD 539.00

5 Days

Rabbit Polyclonal Anti-USP30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP30 antibody: synthetic peptide directed towards the middle region of human USP30. Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
USP30 (NM_032663) Human Tagged Lenti ORF Clone
RC202538L2

USD 1,022.00

3 Weeks

Lenti ORF clone of Human ubiquitin specific peptidase 30 (USP30), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
USP30 Rabbit Polyclonal Antibody
TA315935

USD 380.00

In Stock

Rabbit polyclonal anti-USP30 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human USP30.
USP30 (NM_032663) Human Untagged Clone
SC320718

USD 711.00

In Stock

USP30 (untagged)-Human ubiquitin specific peptidase 30 (USP30)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin