Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Synaptopodin (SYNPO) mouse monoclonal antibody, clone G1D4, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Guinea Pig, Gerbil, Human, Mouse, Rat |
Conjugation | Unconjugated |
Synaptopodin (SYNPO) mouse monoclonal antibody, clone G1D4, Supernatant
Applications | IF, IHC, WB |
Reactivities | Bovine, Guinea Pig, Human, Mouse, Rat |
Conjugation | Unconjugated |
Calca goat polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Mouse, Reptiles, Rat, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic Rat Tyr-CGRP (23-37) conjugated to gamma Globulin |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
Conjugation | Unconjugated |
Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Mouse monoclonal Hsp70/Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila, Fish, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus, Beluga, Hamster, Guinea Pig, C. elegans |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
USD 500.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
Applications | FC, IHC, WB |
Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Monkey, Pig, Rabbit, Helicobacter pylori, Hamster, Spinach, Salmonella Typhimurium, Trichinella spiralis, Yeast, Escherichia coli, White Fly |
Conjugation | Unconjugated |
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
Applications | ELISA, IF, IHC |
Reactivities | Guinea Pig, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
USD 515.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig) |
Conjugation | Unconjugated |
Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Endothelium mouse monoclonal antibody, clone EN4, Purified
Applications | IHC |
Reactivities | Feline, Guinea Pig, Human |
Conjugation | Unconjugated |