EMA (MUC1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human mucin 1, cell surface associated (MUC1), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 2
USD 436.00
Other products for "EMA"
Specifications
Product Data | |
Applications | FC, ICC/IF, IHC, WB |
Recommended Dilution | Knockout Validated, Western Blot: 0.2-1 ug/ml, Immunocytochemistry/ Immunofluorescence: 1:10-1:500, Immunohistochemistry: 1:10-1:500, Flow Cytometry, Immunohistochemistry-Paraffin: 4-8 ug/ml |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Formulation | PBS, 0.02% Sodium Azide. Store at -20C. Avoid freeze-thaw cycles. |
Concentration | lot specific |
Purification | Affinity purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 122 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Gene Name | mucin 1, cell surface associated |
Database Link | |
Background | MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. |
Synonyms | ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; SEC |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.