LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
LEF1 mouse monoclonal antibody,clone OTI10A7, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Biotin |
LEF1 mouse monoclonal antibody,clone OTI10A7, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | HRP |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
LEF1 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human LEF1 |
LEF1 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human LEF1 |
LEF1 mouse monoclonal antibody, clone REMB1, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LEF1 sheep polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A full length protein. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
LEF1 (HMG Binding Domain) mouse monoclonal antibody, clone REMB6, Purified
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LEF1 (HMG Binding Domain) mouse monoclonal antibody, clone REMB6, Purified
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal LEF1 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG |
LEF1 (all isoforms) mouse monoclonal antibody, clone 1C3.1D10, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |