Research Areas

Primary Antibodies (21)
View as table Download

LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

LEF1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human LEF1

LEF1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human LEF1

LEF1 mouse monoclonal antibody, clone REMB1, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LEF1 sheep polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A full length protein.

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ

Rabbit polyclonal LEF1 Antibody (N-term)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1.

Rabbit Polyclonal Anti-LEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG

LEF1 (all isoforms) mouse monoclonal antibody, clone 1C3.1D10, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated