Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal Antibody against PTGDS
| Applications | Simple Western, WB |
| Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
TIMP3 (175-211) rabbit polyclonal antibody, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Bovine, Canine, Equine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 175-211 of Human TIMP3 |
TIMP3 (175-211) rabbit polyclonal antibody, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Bovine, Canine, Equine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 175-211 of Human TIMP3 |
CRM1 (XPO1) (390-408) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Human, Chimpanzee, Mouse, Rat, Bat, Chicken, Equine, Monkey, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the amino acids 390-408 of human Exportin-1 protein |
Eph receptor A2 (EPHA2) (450-500) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Equine, Human, Monkey, Mouse, Rat, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a portion of the amino acids 450-500 of Human EphA2 |
HOX11 (TLX1) (306-318) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence corresponding to acids amino acids 306-318 of human HOX11 |
Alcohol Dehydrogenase rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Equine |
| Conjugation | Unconjugated |
| Immunogen | Alcohol dehydrogenase isolated and purified from Horse Liver. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Alcohol Dehydrogenase rabbit polyclonal antibody, Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Equine |
| Conjugation | Unconjugated |
| Immunogen | Alcohol dehydrogenase isolated and purified from Horse liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Germany
Japan
United Kingdom
China
