Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
IL18 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-IL18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | C-His |
Expression Host | HEK293 |
IL18 MS Standard C13 and N15-labeled recombinant protein (NP_001553)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | Tag Free |
Expression Host | E. coli |
IL18 (untagged) - Homo sapiens interleukin 18 (interferon-gamma-inducing factor) (IL18), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | Tag Free |
Expression Host | E. coli |
Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)
Tag | Tag Free |
Expression Host | E. coli |