Autoimmunity

cDNA Clones (14)
Proteins (13)
Antibodies (3)
Jump to Filters
View as table Download
IL18 (NM_001562) Human Tagged Lenti ORF Clone
RC202716L1

USD 600.00

In Stock

Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
IL18 (NM_001562) Human Tagged Lenti ORF Clone
RC202716L4

USD 600.00

In Stock

Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IL18 (NM_001562) Human Tagged Lenti ORF Clone
RC202716L2

USD 600.00

3 Weeks

Lenti ORF clone of Human interleukin 18 (interferon-gamma-inducing factor) (IL18), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
IL18 (NM_001562) Human Over-expression Lysate
LC400599

USD 134.00

In Stock

IL18 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
IL18 Rabbit Polyclonal Antibody
TA343041

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS
IL18 (NM_001562) Human Recombinant Protein
TP720840

USD 330.00

5 Days

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag C-His
Expression Host HEK293
IL18 (NM_001562) Human Mass Spec Standard
PH302716

USD 3,255.00

3 Weeks

IL18 MS Standard C13 and N15-labeled recombinant protein (NP_001553)

Tag C-Myc/DDK
Expression Host HEK293
IL18 (NM_001562) Human Recombinant Protein
TP721161

USD 330.00

15 Weeks

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag Tag Free
Expression Host E. coli
IL18 (NM_001243211) Human Untagged Clone
SC330096

USD 330.00

3 Weeks

IL18 (untagged) - Homo sapiens interleukin 18 (interferon-gamma-inducing factor) (IL18), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
IL18 (NM_001562) Human Recombinant Protein
TP720840L

USD 1,900.00

9 Weeks

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag C-His
Expression Host HEK293
IL18 (NM_001562) Human Recombinant Protein
TP720840M

USD 760.00

5 Days

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag C-His
Expression Host HEK293
IL18 (NM_001562) Human Recombinant Protein
TP720840XL

USD 2,800.00

7 Weeks

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag C-His
Expression Host HEK293
IL18 (NM_001562) Human Recombinant Protein
TP721161L

USD 1,900.00

9 Weeks

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag Tag Free
Expression Host E. coli
IL18 (NM_001562) Human Recombinant Protein
TP721161M

USD 760.00

15 Weeks

Purified recombinant protein of Human interleukin 18 (interferon-gamma-inducing factor) (IL18)

Tag Tag Free
Expression Host E. coli
IL18 CytoSection
TS402716P5

USD 1,174.00

4 Weeks

Transient overexpression of IL18 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names IGIF; IL-1g; IL-18; IL1F4
Accession Number NM_001562, NP_001553