CD63 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD63 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
CD82 mouse monoclonal antibody, clone C33, Aff - Purified
Applications | FC, FN, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD9 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human CD9. |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
CD63 mouse monoclonal antibody, clone MEM-259, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
Applications | FC, FN, IF, IHC, IP, WB |
Reactivities | Feline, Human, Rabbit |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
TAPA1 (CD81) rat monoclonal antibody, clone QV-6A8-S3, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal CD81 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81. |
CD63 mouse monoclonal antibody, clone MX-49.129.5, Purified
Applications | ELISA, FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CD9 mouse monoclonal antibody, clone MM2/57, Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Canine, Equine, Feline, Human, Rabbit |
Conjugation | Unconjugated |
CD81 / TAPA1 hamster monoclonal antibody, clone Eat2, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD81 / TAPA1 hamster monoclonal antibody, clone Eat2, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
CD81 / TAPA1 hamster monoclonal antibody, clone Eat2, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |