ADRB1 (Myc-DDK-tagged)-Human adrenergic, beta-1-, receptor (ADRB1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ADRB1 (Myc-DDK-tagged)-Human adrenergic, beta-1-, receptor (ADRB1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADRB1 (tGFP-tagged) - Human adrenergic, beta-1-, receptor (ADRB1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
USD 986.00
In Stock
Lenti ORF clone of Human adrenergic, beta-1-, receptor (ADRB1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 986.00
In Stock
Lenti ORF clone of Human adrenergic, beta-1-, receptor (ADRB1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
USD 986.00
3 Weeks
Lenti ORF clone of Human adrenergic, beta-1-, receptor (ADRB1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 986.00
3 Weeks
Lenti ORF clone of Human adrenergic, beta-1-, receptor (ADRB1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
ADRB1 (untagged)-Human adrenergic, beta-1-, receptor (ADRB1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-ADRB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB1 . |
USD 1,236.00
5 Weeks
Lenti ORF particles, ADRB1 (Myc-DDK tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,236.00
2 Weeks
Lenti ORF particles, ADRB1 (mGFP-tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,236.00
5 Weeks
Lenti ORF particles, ADRB1 (Myc-DDK tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,236.00
2 Weeks
Lenti ORF particles, ADRB1 (mGFP-tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |