B Cell Lineage

cDNA Clones (11)
Antibodies (3)
Jump to Filters
View as table Download
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA329147

USD 485.00

In Stock

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA313441

USD 380.00

4 Weeks

Rabbit polyclonal anti-ADRB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB1 .
beta 1 Adrenergic Receptor (ADRB1) (NM_000684) Human Tagged ORF Clone Lentiviral Particle
RC217134L3V

USD 1,236.00

5 Weeks

Lenti ORF particles, ADRB1 (Myc-DDK tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
beta 1 Adrenergic Receptor (ADRB1) (NM_000684) Human Tagged ORF Clone Lentiviral Particle
RC217134L4V

USD 1,236.00

2 Weeks

Lenti ORF particles, ADRB1 (mGFP-tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®