Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Zscan12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Zscan12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISL |
Rabbit Polyclonal Anti-Zscan12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Zscan12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: WEGTEAEQNPASRLAKDALECEEAHNPGEESSGISHEDSQPLRNENGVNS |
ZSCAN12 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12 |
Active filters
Target Symbol
- ZSCAN12