Zscan12 Rabbit Polyclonal Antibody

CAT#: TA345654

Rabbit Polyclonal Anti-Zscan12 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Zscan12"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Zscan12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: WEGTEAEQNPASRLAKDALECEEAHNPGEESSGISHEDSQPLRNENGVNS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name zinc finger and SCAN domain containing 12
Background ZSCAN12 may be involved in transcriptional regulation.
Synonyms dJ29K1.2; KIAA0426; OTTHUMP00000016205; ZFP96; ZNF29K1; ZNF96; ZNF305
Note Immunogen Sequence Homology: Mouse: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.