Antibodies

Jump to Filters
View as table Download
TTC9C (N-term) Rabbit Polyclonal Antibody
AP54404PU-N

USD 580.00

2 Weeks

TTC9C (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 4-33 amino acids from the N-terminal region of human TTC9C
TTC9C Rabbit Polyclonal Antibody
TA331417

USD 539.00

5 Days

Rabbit polyclonal Anti-TTC9C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TTC9C antibody: synthetic peptide directed towards the N terminal of human TTC9C. Synthetic peptide located within the following region: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP