TTC9C Rabbit Polyclonal Antibody

CAT#: TA331417

Rabbit polyclonal Anti-TTC9C Antibody

Product Images

WB Suggested Anti-TTC9C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TTC9C antibody: synthetic peptide directed towards the N terminal of human TTC9C. Synthetic peptide located within the following region: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: tetratricopeptide repeat domain 9C
• Database Link:
  NP_776171
  Entrez Gene 283237 Human
  UniProt ID Q8N5M4
• Background: The specific function of the protein remains unknown.
• Synonyms: MGC29649
• Note: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Goat: 86%; Bovine: 86%; Guinea pig: 77%