Antibodies

Jump to Filters
View as table Download
TNNT3 (C-term) Goat Polyclonal Antibody
AP32711PU-N

USD 520.00

5 Days

TNNT3 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the C-Terminus of the protein sequence according to NP_006748.1; NP_001036246.1; NP_001036247.1.
Fast skeletal muscle Troponin T Mouse Monoclonal Antibody [Clone ID: T1/61]
SM1372P

USD 640.00

5 Days

Fast skeletal muscle Troponin T mouse monoclonal antibody, clone T1/61, Purified

Applications ELISA, IHC, WB
Reactivities Chicken, Human
Conjugation Unconjugated
TNNT3 Rabbit Polyclonal Antibody
TA339176

USD 485.00

5 Days

Rabbit Polyclonal Anti-TNNT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the N terminal of human TNNT3. Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
TNNT3 Rabbit Polyclonal Antibody
TA339175

USD 539.00

5 Days

Rabbit Polyclonal Anti-TNNT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the C terminal of human TNNT3. Synthetic peptide located within the following region: QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK
TNNT3 Rabbit Polyclonal Antibody
TA382684

USD 365.00

3 Weeks

TNNT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 147-256 of human TNNT3 (NP_001036246.1).
Modifications Unmodified