SNAP47 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAP47 |
SNAP47 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAP47 |
Rabbit Polyclonal Anti-CAT Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
SNAP47 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAP47 |
Rabbit Polyclonal Anti-C1orf142 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA |