SNAP47 Rabbit Polyclonal Antibody

CAT#: TA344347

Rabbit Polyclonal Anti-C1orf142 Antibody - middle region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of synaptosomal-associated protein, 47kDa (SNAP47)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "SNAP47"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name synaptosome associated protein 47kDa
Background The function of this protein remains unknown.
Synonyms C1orf142; ESFI5812; HEL-S-290; HEL170; SNAP-47; SVAP1
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Zebrafish: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Yeast: 75%
Reference Data
Protein Pathways SNARE interactions in vesicular transport

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.