NUF2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NUF2 |
NUF2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NUF2 |
Rabbit Polyclonal Anti-NUF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NUF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NUF2. Synthetic peptide located within the following region: EIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLE |
Rabbit polyclonal antibody to CDCA1 (CDCA1, NDC80 kinetochore complex component, homolog (S. cerevisiae))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NUF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NUF2 |
Nuf2 Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |