Antibodies

View as table Download

NUF2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NUF2

Rabbit Polyclonal Anti-NUF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NUF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NUF2. Synthetic peptide located within the following region: EIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLE

Rabbit polyclonal antibody to CDCA1 (CDCA1, NDC80 kinetochore complex component, homolog (S. cerevisiae))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-NUF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NUF2

Nuf2 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated