Rabbit Polyclonal Anti-MMP23B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MMP23B |
Rabbit Polyclonal Anti-MMP23B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MMP23B |
Rabbit polyclonal anti-MMP-23 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-23 antibody. |
Rabbit polyclonal MMP23 (Cleaved-Tyr79) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP23. |
MMP23 (MMP23B) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | MMP23B antibody was raised against a synthetic peptide derived from C-terminus of human MMP-23 protein |
Rabbit Polyclonal Anti-MMP23B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the middle region of human MMP23B. Synthetic peptide located within the following region: QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV |
Rabbit Polyclonal Anti-MMP23B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the N terminal of human MMP23B. Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP |
Rabbit Polyclonal Anti-MMP23 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP23 Antibody: A synthesized peptide derived from human MMP23 |
Rabbit anti MMP-23 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |