MMP23 (MMP23B) Rabbit Polyclonal Antibody

CAT#: TA341873

Rabbit Polyclonal Anti-MMP23B Antibody

Product Images

WB Suggested Anti-MMP23B Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the N terminal of human MMP23B. Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: matrix metallopeptidase 23B
• Database Link:
  NP_008914
  Entrez Gene 8510 Human
  UniProt ID O75900
• Background: This gene (MMP23B) encodes a member ofThe matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins ofThe matrix metalloproteinase (MMP) family are involved inThe breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.This gene belongs toThe more telomeric copy ofThe duplicated region. [provided by RefSeq, Jul 2008]
• Synonyms: MIFR; MIFR-1; MMP22; MMP23A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane