Rabbit Polyclonal Anti-KIAA1754L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIAA1754L Antibody: synthetic peptide directed towards the C terminal of human KIAA1754L. Synthetic peptide located within the following region: EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT |
Rabbit Polyclonal Anti-KIAA1754L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIAA1754L Antibody: synthetic peptide directed towards the C terminal of human KIAA1754L. Synthetic peptide located within the following region: IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA |
Germany
Japan
United Kingdom
China