ITPRIPL1 Rabbit Polyclonal Antibody

CAT#: TA336137

Rabbit Polyclonal Anti-KIAA1754L Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of inositol 1,4,5-triphosphate receptor interacting protein-like 1 (ITPRIPL1), transcript variant 1
    • 100 ug

USD 436.00

Other products for "ITPRIPL1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KIAA1754L Antibody: synthetic peptide directed towards the C terminal of human KIAA1754L. Synthetic peptide located within the following region: EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name inositol 1,4,5-trisphosphate receptor interacting protein-like 1
Background The function remains unknown.
Synonyms KIAA1754L
Note Immunogen Sequence Homology: Human: 100%; Rat: 85%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.