Rabbit Polyclonal FAM3C Antibody
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 40-80 of human FAM3C was used as the immunogen for this antibody. |
Rabbit Polyclonal FAM3C Antibody
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 40-80 of human FAM3C was used as the immunogen for this antibody. |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
Applications | IHC |
Reactivities | Bovine, Chimpanzee, Chicken, Dog, Human, Monkey, Mouse, Opossum, Rat, Pufferfish |
Conjugation | Unconjugated |
Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Rabbit Polyclonal Anti-FAM3C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM3C Antibody: synthetic peptide directed towards the C terminal of human FAM3C. Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD |
FAM3C Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM3C |