FMO2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FMO2 |
FMO2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FMO2 |
Rabbit polyclonal antibody to FMO2 (flavin containing monooxygenase 2 (non-functional))
Applications | IHC, WB |
Reactivities | Human (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 74 and 354 of FMO2 (Uniprot ID#Q99518) |
Rabbit Polyclonal Anti-FMO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMO2 antibody: synthetic peptide directed towards the N terminal of human FMO2. Synthetic peptide located within the following region: KYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVFDAVMVCSGHHI |
FMO2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FMO2 |